DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and CG18585

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001260213.1 Gene:CG18585 / 34041 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster


Alignment Length:335 Identity:110/335 - (32%)
Similarity:180/335 - (53%) Gaps:16/335 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HLEYKVLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLSAFYTHSEINDYLDSLLERFPKRVQVKQ 69
            ::..:::||::...:..::...........|      :.:|...||..:||.:|..:|...:...
  Fly    89 NISSELMIENVQERIDEEQVTPTADSATFGW------TKYYELEEIEAWLDEILNAYPSVTEEFI 147

  Fly    70 FGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNY-GDNQELLQD 133
            .|.|||.|.::.:.|::..|   .|.|.|:..:||||||:.:.|.:.|.|||.:. .|.:.|..:
  Fly   148 VGKSYEGRTIRGIKISHKAG---NPGIFIESNIHAREWITSASATWFINQLLTSEDADVRSLADN 209

  Fly   134 YDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEGSSSDPCENIYR 198
            |||.|:||.|.||:||:|...|.|||:|:|.:...|||.|.||||...|..:.|:|.:||...:.
  Fly   210 YDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGADANRNFDSYWLQNNGASDNPCSETFA 274

  Fly   199 GERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTS-DFPDTYQDMMSVADAGA-- 260
            |:.|..:.|::.|.:.:...:.:::.|:|.||||.|.|.|:|:|: :||:.|.|::::..|.|  
  Fly   275 GDNPESEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYGHTNEEFPENYNDILTIGKAFADA 339

  Fly   261 -KAIIYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATVAMTMELPAAGFQGFDPWISQIERLV 324
             :|:.|.|  :|.||||..|||..:|.:.|:.|..:...:..|:|....|..||.....||....
  Fly   340 IEALPYGT--VYQYGSTADVLYVATGTSVDWVFNELGKKIGYTIEYRDKGRYGFILPPVQIIPNC 402

  Fly   325 TESWVGVRAM 334
            .|..||:.|:
  Fly   403 EELMVGMLAL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 107/296 (36%)
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 2/15 (13%)
M14_CP_A-B_like 122..415 CDD:199844 107/296 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466997
Domainoid 1 1.000 158 1.000 Domainoid score I1007
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - otm46992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.