DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and AGBL3

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_848658.3 Gene:AGBL3 / 340351 HGNCID:27981 Length:920 Species:Homo sapiens


Alignment Length:300 Identity:69/300 - (23%)
Similarity:101/300 - (33%) Gaps:84/300 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QWPHIDVLSAF-----YTHSEINDYL-----DSLLERFPKRVQVKQFGWSYERRPLKVLTIT--- 85
            |:||......|     ||::.:.:||     |.:..:|.|   ::....:..|..:.:||||   
Human   285 QFPHNKDTCYFAHCYPYTYTNLQEYLSGINNDPVRSKFCK---IRVLCHTLARNMVYILTITTPL 346

  Fly    86 -NGDGRRNKPVILIDGTVHARE----WISPSMALYIIQQLLDNYGDNQELLQDYDWVIMPVVNAD 145
             |.|.|:.|.||| ...||..|    ||......||    |.|..|.|.|...:.:.::|::|.|
Human   347 KNSDSRKRKAVIL-TARVHPGETNSSWIMKGFLDYI----LGNSSDAQLLRDTFVFKVVPMLNPD 406

  Fly   146 GYEYTHTDSRYWRKSRRPTSNPEC--IGTDINRN--------FGYEW------------------ 182
            |.               ...|..|  .|.|:|||        |...|                  
Human   407 GV---------------IVGNYRCSLAGRDLNRNYTSLLKESFPSVWYTRNMVHRLMEKREVILY 456

  Fly   183 ----GHDEGSS--------SDPCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYF 235
                ||....:        ||..:.:|..:|.|....|:...|.......:.|...|....|...
Human   457 CDLHGHSRKENIFMYGCDGSDRSKTLYLQQRIFPLMLSKNCPDKFSFSACKFNVQKSKEGTGRVV 521

  Fly   236 LLPWGYTSDFPDTYQDMMSVADAGAK-AIIYSTNGIYSYG 274
            :...|..:.|  |.:.....:..|.| ...:||..:.|.|
Human   522 MWKMGIRNSF--TMEATFCGSTLGNKRGTHFSTKDLESMG 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 65/289 (22%)
AGBL3NP_848658.3 M14_AGBL2-3_like 310..570 CDD:133117 61/274 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 641..661
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.