DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and CG31019

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_733391.1 Gene:CG31019 / 318558 FlyBaseID:FBgn0051019 Length:659 Species:Drosophila melanogaster


Alignment Length:326 Identity:73/326 - (22%)
Similarity:122/326 - (37%) Gaps:102/326 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IQWPHIDVLSAFYTHSEINDYLDSL------LERFPKRVQVKQFGWSYERRPLKVLTI------- 84
            :.||        |::|.:..||:.:      .:||.:.|.||    |.:.|.:.:|||       
  Fly   174 LAWP--------YSYSRLQSYLNVIDARQGSDKRFTRCVLVK----SLQNRNVDLLTIDHVTAKQ 226

  Fly    85 --TNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDNQELLQDYDWVIMPVVNADGY 147
              ||...|....||::....|:.|..:..:...:|:.|:.|:.....|..::.:.|:|:||.||.
  Fly   227 RSTNRLDRSFIRVIVVLCRTHSSEAPASHVCQGLIEFLVGNHPIAAVLRDNFVFKIVPMVNPDGV 291

  Fly   148 EYTHTDSRYWRKSRRPTSNPEC--IGTDINRNFGYEWGHDEGSSSDPCENIYRGE-RPFDQSESQ 209
            .               ..|..|  :|.|:|||    | |.....:.|..:..:|. :..|.|:  
  Fly   292 F---------------LGNNRCNLMGQDMNRN----W-HIGSEFTQPELHAVKGMLKELDNSD-- 334

  Fly   210 VLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPDTYQDMMSVADAGAKAIIYSTNGIYSYG 274
            |.|.:.....|              .:....|...| .||| :..|.|..|.:   |.:|.:.||
  Fly   335 VSRGIETDLIG--------------IIFVCSYNISF-QTYQ-IDFVIDLHANS---SMHGCFIYG 380

  Fly   275 STY--------YVLYP----------------------TSGDTTDFAFGVVNATV-AMTMELPAA 308
            :||        ::::|                      .:|....|:...::.|| |.|:|:..|
  Fly   381 NTYEDVYRYERHLVFPRLFASNAQDYVADHTMFNADERKAGSMRRFSCERLSDTVNAYTLEVSMA 445

  Fly   309 G 309
            |
  Fly   446 G 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 71/315 (23%)
CG31019NP_733391.1 M14_AGBL4_like 190..478 CDD:133118 67/302 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.