DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and CG3097

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster


Alignment Length:348 Identity:105/348 - (30%)
Similarity:170/348 - (48%) Gaps:22/348 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YHLEYKVLIEDLAPLVHAQRAENLR----------KKLL---IQWPHIDVLSAFYTHSEINDYLD 55
            :.|:.::|..::..::..:..|.::          ||..   :.|.....|...|:      ::.
  Fly   101 HRLDPQILSHNIQSMIDEELLEGIQSSSFGHGRRTKKAARSSMHWKDYHDLETIYS------FMR 159

  Fly    56 SLLERFPKRVQVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQL 120
            .:..:||..|::...|.:.|.|.||||.|:. :.|.||.| .|||.:||||||||:...:|:.||
  Fly   160 EIRTKFPNIVRLYTIGQTAEGRDLKVLRISE-NPRENKKV-WIDGGIHAREWISPATVTFILYQL 222

  Fly   121 LDNYGDNQELLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHD 185
            :.::.:....::...|.||||:|.|||||:.|.:|.|||:|.|:...:|.|.|:||||...| :.
  Fly   223 MSDWENQPAHIRGLTWYIMPVMNPDGYEYSRTTNRLWRKNRSPSRRAQCSGVDLNRNFDIGW-NG 286

  Fly   186 EGSSSDPCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPDTYQ 250
            .|||::||.:.|||..|..:.|::.:.:.:...|..|..||:.||||...:.||.|.:.......
  Fly   287 YGSSTNPCSDTYRGSAPASERETRAVAEFLAKRKYNLESYLTFHSYGQMIVYPWAYKAVKVKDAS 351

  Fly   251 DMMSVADAGAKAIIYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATVAMTMELPAAGFQGFDP 315
            .:..|:...|:.|:..|...|....|:.||....|.:.|::...:......|:||...|..||..
  Fly   352 VLQRVSSLAAERILQKTGTSYRAAVTHEVLGIAGGGSDDWSRAALGVKYVYTIELRDRGAYGFVL 416

  Fly   316 WISQIERLVTESWVGVRAMAAEV 338
            ....|:....|.|..|..:|..:
  Fly   417 PPRFIKDTALEGWTVVETVAQAI 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 98/293 (33%)
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 2/16 (13%)
M14_CP_A-B_like 148..439 CDD:199844 99/299 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466937
Domainoid 1 1.000 158 1.000 Domainoid score I1007
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - otm46992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.