DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and Cpa6

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_038965675.1 Gene:Cpa6 / 312913 RGDID:1311764 Length:290 Species:Rattus norvegicus


Alignment Length:295 Identity:94/295 - (31%)
Similarity:156/295 - (52%) Gaps:26/295 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PKRVQVKQFGWSYERRPLKVLTITNGDGRRN---KPVILIDGTVHAREWISPSMALYIIQQLLDN 123
            |..|:|...|.|:|.|.|.::.:    ||::   |..:.||..:||||||.|:...:.:::.:..
  Rat     9 PGLVRVFPIGRSFEGRSLLIIQL----GRKSQVYKRAVWIDCGIHAREWIGPAFCQWFVKEAILT 69

  Fly   124 YGDN---QELLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHD 185
            |..:   :::|....:.||||:|.|||.::.|..|:|||:|...|...|.|.|.|||:..:| .|
  Rat    70 YKTDPAMRKMLNHLYFYIMPVLNVDGYHFSWTHDRFWRKTRSRNSKFHCRGVDANRNWKVKW-CD 133

  Fly   186 EGSSSDPCENIYRGERPFDQSESQV--LRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPDT 248
            ||:|:|||::.|.|  ||.:||.:|  :.:.:..::.|:..|||.|:|....|.|:.|..   .|
  Rat   134 EGASADPCDDTYCG--PFPESEPEVKAVANFLRKHRKRIRAYLSFHAYAQMLLYPYSYKH---AT 193

  Fly   249 YQDMMSVADAGAKAI--IYSTNGI-YSYGSTYYVLYPTSGDTTDFAF--GVVNATVAMTMELPAA 308
            ..:...|..|..||:  :.|.:|| |.:|.....||.:||::.|:|:  |:   ..:...||...
  Rat   194 IPNFSCVEFAAHKAVKALRSVHGIRYRHGPASQTLYVSSGNSMDWAYKNGI---PYSFAFELRDT 255

  Fly   309 GFQGFDPWISQIERLVTESWVGVRAMAAEVIRRYP 343
            |:.||......|:...||:.:.|:.:...:::..|
  Rat   256 GYFGFLLPEMLIKPTCTETMLAVKNITMHLLKNCP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 93/288 (32%)
Cpa6XP_038965675.1 Peptidase_M14_like 1..289 CDD:416253 93/292 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351663
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.