DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and Agbl2

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_848870.2 Gene:Agbl2 / 271813 MGIID:2443254 Length:862 Species:Mus musculus


Alignment Length:302 Identity:66/302 - (21%)
Similarity:110/302 - (36%) Gaps:74/302 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QWPHIDVLSAF------YTHSEINDYLDSLLERFPKRVQ---VKQFGWSYERRPLKVLTITNGDG 89
            |:|| |..:.|      ||::::..||.|:... |.:.|   ::....|.....:.:|||||...
Mouse   345 QFPH-DQDTCFFAHFYPYTYTDLQCYLLSVANN-PIQSQFCKLRALCRSLAGNTVYLLTITNPSR 407

  Fly    90 RRN----KPVILIDGTVHARE----WISPSMALYIIQQLLDNYGDNQELLQDYDWVIMPVVNADG 146
            ...    |..:::...||..|    ||......:|    |.|..|.|.|...:.:.::|::|.||
Mouse   408 TPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFI----LSNSPDAQLLRDIFVFKVIPMLNPDG 468

  Fly   147 YEYTHTDSRYWRKSRRPTSNPEC--IGTDINRNFGYEWGHDEGSSSDPC----ENIYRGERPFDQ 205
            .               ...|..|  .|.|:||::     ......|.||    :|:.:  |..::
Mouse   469 V---------------IVGNYRCSLAGRDLNRHY-----KTVLKDSFPCIWYTKNMIK--RLLEE 511

  Fly   206 SESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPDTYQDMMSVADAGAKAIIYSTNGI 270
            .|..:..|...|.:....|....||.....   |.:...||     :|...:|..|         
Mouse   512 REVLLYCDFHGHSRKNNIFLYGCHSNNRKH---WLHERVFP-----LMLSKNAPDK--------- 559

  Fly   271 YSYGSTYYVLYPT---SGDTTDFAFGVVNATVAMTMELPAAG 309
            :|:.|..:.:...   :|....:..|::|   :.|||....|
Mouse   560 FSFDSCNFKVQKCKEGTGRVVMWRMGIIN---SYTMESTFGG 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 62/292 (21%)
Agbl2NP_848870.2 Pepdidase_M14_N 231..358 CDD:375499 5/13 (38%)
M14_AGBL2-3_like 379..629 CDD:349478 55/266 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 669..692
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 704..728
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 750..836
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.