powered by:
Protein Alignment CG32379 and oxy-5
DIOPT Version :9
Sequence 1: | NP_729252.2 |
Gene: | CG32379 / 326211 |
FlyBaseID: | FBgn0052379 |
Length: | 344 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001293404.1 |
Gene: | oxy-5 / 24104659 |
WormBaseID: | WBGene00045483 |
Length: | 162 |
Species: | Caenorhabditis elegans |
Alignment Length: | 53 |
Identity: | 17/53 - (32%) |
Similarity: | 22/53 - (41%) |
Gaps: | 15/53 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 160 SRRPTSNPECIGT--DINRNFGYEWG------HDEGSSSDPCENI-----YRG 199
|..||:: .||. .|.|..|.||. ..:|.|.:.||.: |||
Worm 112 SSTPTAS--SIGPVGKIPRGQGIEWNQLPQRFQRQGMSEEECEAVNTGFFYRG 162
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2866 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.