DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and cpd-2

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_510625.2 Gene:cpd-2 / 181684 WormBaseID:WBGene00012073 Length:492 Species:Caenorhabditis elegans


Alignment Length:343 Identity:73/343 - (21%)
Similarity:128/343 - (37%) Gaps:82/343 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EYKVLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLS-AFYTHSEINDYLDSLLERFPKRVQVKQF 70
            |.::||............:.||..:   .|..|.|: :...:|.:.|::.:|..:||....:...
 Worm    23 EEQMLIRHFTKEGEVSTMDQLRDTI---GPFRDPLNFSHMNYSTLTDHIHNLHRKFPNLTHIYSA 84

  Fly    71 GWSYERRPLKVLTITNG--DGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDN---QEL 130
            |.|.:.|.|.||.::..  :.|:..|.......:|..|.......:.:...||:||..|   ::|
 Worm    85 GQSVQGRELWVLVVSRYPIEHRKLIPEFKYVANMHGNEVTGRVFLVSLAHTLLENYNSNLWIRQL 149

  Fly   131 LQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEGSSSDPCEN 195
            :......:||.:|.||||:.....:.....|:..:     |.|:||||             |.  
 Worm   150 VDSTRIHLMPSMNPDGYEHASEGDQAGVTGRQNAN-----GKDLNRNF-------------PS-- 194

  Fly   196 IYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPD------------- 247
              |....|..||.|.....::::..::.|.||.:.:|...|:.:.: .|||.             
 Worm   195 --RFPNYFPTSEIQPETIAIMNWTRQIPFALSANLHGGTTLVNYPF-DDFPTRTRQSHYAPSPDN 256

  Fly   248 --------TY---------------QDMMSVADAGAKAIIYSTNGIYSYGSTYYVLYPTSGDTTD 289
                    ||               .|.::::       :...|||.: |:.:|::   ||...|
 Worm   257 ALFVRLAYTYARGHERMWKKGPRCLDDDLNIS-------VDPQNGIIN-GADWYIV---SGGMQD 310

  Fly   290 FAFGVVN---ATVAMTME 304
            :.:...|   .||.|..|
 Worm   311 WNYLNTNCFEVTVEMNCE 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 65/305 (21%)
cpd-2NP_510625.2 M14_CP_N-E_like 58..352 CDD:349431 65/305 (21%)
Peptidase_M14NE-CP-C_like 358..433 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4667
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.