DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and CPA3

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens


Alignment Length:347 Identity:103/347 - (29%)
Similarity:181/347 - (52%) Gaps:31/347 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LEYKVLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLSAFYTHSEIND------YLDSLLERFPKR 64
            :.|::||.||        .|.:.|:..::    :.:...:::::.|:      :.:.:::::|:.
Human    87 MHYEILIHDL--------QEEIEKQFDVK----EDIPGRHSYAKYNNWEKIVAWTEKMMDKYPEM 139

  Fly    65 VQVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDNQ- 128
            |...:.|.:.|..||.||.|  |:....:..|..|..:|||||:||:...:.:.|....||.|: 
Human   140 VSRIKIGSTVEDNPLYVLKI--GEKNERRKAIFTDCGIHAREWVSPAFCQWFVYQATKTYGRNKI 202

  Fly   129 --ELLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEGSSSD 191
              :||...::.|:||.|.|||.::.|.:|.|||:|....|.:|||||:||||...| :...:::|
Human   203 MTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNSKCIGTDLNRNFNASW-NSIPNTND 266

  Fly   192 PCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPDTYQDMMSVA 256
            ||.:.|||..|..:.|::.:.:.:..:...:..|::.|||....|.|:||||..|..::|:..||
Human   267 PCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGYTSKLPPNHEDLAKVA 331

  Fly   257 DAGAKAII--YSTNGIYSYGSTYYVLYPTSGDTTDFAFGV-VNATVAMTMELPAAGFQGFDPWIS 318
            ..|...:.  |.|.  |.||.....:||.||.:.|:|:.: :..|.|  .||...|..||....|
Human   332 KIGTDVLSTRYETR--YIYGPIESTIYPISGSSLDWAYDLGIKHTFA--FELRDKGKFGFLLPES 392

  Fly   319 QIERLVTESWVGVRAMAAEVIR 340
            :|:....|:.:.|:.:|..:::
Human   393 RIKPTCRETMLAVKFIAKYILK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 96/305 (31%)
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 6/22 (27%)
M14_CPB 114..413 CDD:199852 96/305 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157643
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.