DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and Cpa3

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_031779.1 Gene:Cpa3 / 12873 MGIID:88479 Length:417 Species:Mus musculus


Alignment Length:352 Identity:108/352 - (30%)
Similarity:182/352 - (51%) Gaps:31/352 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRNYHLEYKVLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLSAFYTHSEIND------YLDSLLE 59
            :..:.:.|::||.||        .|.:.|:..::    |.::..:::::.||      :.:.:||
Mouse    82 LEQHKIHYEILIHDL--------QEEIEKQFDVK----DEIAGRHSYAKYNDWDKIVSWTEKMLE 134

  Fly    60 RFPKRVQVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNY 124
            :.|:.|...:.|.:.|..||.||.|...||.|.  .|.:|..:||||||||:...:.:.|...:|
Mouse   135 KHPEMVSRIKIGSTVEDNPLYVLKIGKKDGERK--AIFMDCGIHAREWISPAFCQWFVYQATKSY 197

  Fly   125 GDNQ---ELLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDE 186
            |.|:   :||...::.::||.|.|||.::.|..|.|||:|....|..|||||:||||...| ...
Mouse   198 GKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTQDRMWRKNRSRNQNSTCIGTDLNRNFDVSW-DSS 261

  Fly   187 GSSSDPCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPDTYQD 251
            .:::.||.|:|||..|..:.|::.:.:.:..:...:..|::.|||....|:|:|||...|..:||
Mouse   262 PNTNKPCLNVYRGPAPESEKETKAVTNFIRSHLNSIKAYITFHSYSQMLLIPYGYTFKLPPNHQD 326

  Fly   252 MMSVADAGAKAII--YSTNGIYSYGSTYYVLYPTSGDTTDFAFGV-VNATVAMTMELPAAGFQGF 313
            ::.||.....|:.  |.|.  |.||.....:|.|||.:.|:.:.: :..|.|  .||...|..||
Mouse   327 LLKVARIATDALSTRYETR--YIYGPIASTIYKTSGSSLDWVYDLGIKHTFA--FELRDKGKSGF 387

  Fly   314 DPWISQIERLVTESWVGVRAMAAEVIR 340
            ....|:|:....|:.:.|:.:|..:::
Mouse   388 LLPESRIKPTCKETMLSVKFIAKYILK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 100/305 (33%)
Cpa3NP_031779.1 Propep_M14 28..102 CDD:280416 6/27 (22%)
Peptidase_M14_like 114..413 CDD:299699 100/305 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848046
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.