DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and AGBL1

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001373023.1 Gene:AGBL1 / 123624 HGNCID:26504 Length:1121 Species:Homo sapiens


Alignment Length:280 Identity:59/280 - (21%)
Similarity:99/280 - (35%) Gaps:103/280 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IQWPHIDVLSAF-----YTHSEINDYLDSLLERFPKRVQVKQFGWSYERR----------PLKVL 82
            :.:||.:.:...     ||::.:..:|| :||   |.|.:|:.   |.|:          |..::
Human   717 VTFPHSEDVCYLAYHYPYTYTALMTHLD-ILE---KSVNLKEV---YFRQDVLCQTLGGNPCPLV 774

  Fly    83 TIT-----NGDGR----RNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDNQE----LLQDY 134
            |||     |.|..    |::|..:|...||..|    |.|.::::..|:....:..    |.:::
Human   775 TITAMPESNSDEHLEQFRHRPYQVITARVHPGE----SNASWVMKGTLEFLVSSDPVARLLRENF 835

  Fly   135 DWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPEC--IGTDINRNFGYEWGHDEGSSSDPCENIY 197
            .:.|:|::|.||.               ...|..|  .|.|:||    :|               
Human   836 IFKIIPMLNPDGV---------------INGNHRCSLSGEDLNR----QW--------------- 866

  Fly   198 RGERPFDQSESQVLRDVMLHYKGRLNFYLS-----------LHSYG---NYFLLPWGYTSDFPDT 248
                   .|.|..|:..:.|.||.| ::||           .|.:.   |.||    |.....:|
Human   867 -------LSPSAHLQPTIYHAKGLL-YHLSSIGRSPVVFCDFHGHSQKKNVFL----YGCSIKET 919

  Fly   249 YQDMMSVADAGAKAIIYSTN 268
            .  ..:....|...|:...|
Human   920 L--WQAACTVGTSTILEEVN 937

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 57/269 (21%)
AGBL1NP_001373023.1 Pepdidase_M14_N 596..730 CDD:407865 2/12 (17%)
M14_Nna1 754..1019 CDD:349477 48/239 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.