DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and cpo

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo / 100005630 ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio


Alignment Length:297 Identity:98/297 - (32%)
Similarity:156/297 - (52%) Gaps:9/297 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FYTHSEINDYLDSLLERFPKRVQVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWI 108
            ::|..||:.:::.:....|..|....:|.:||:|.:.:|.| .......|..|.:|..:||||||
Zfish    35 YHTMDEISAWMNQMQRENPDVVSTMTYGQTYEKRNITLLKI-GFSSTTPKKAIWMDCGIHAREWI 98

  Fly   109 SPSMALYIIQQLLDNYGDNQE---LLQDYDWVIMPVVNADGYEYT--HTDSRYWRKSRRPT-SNP 167
            :|:...:.::::|.:|..:..   |.::.|:.|.||:|.|||.|:  :..:|.|||||.|. .|.
Zfish    99 APAFCQHFVKEVLGSYKTDSRVNMLFKNLDFYITPVLNMDGYIYSWLNNSTRLWRKSRSPCHENS 163

  Fly   168 ECIGTDINRNFGYEWGHDEGSSSDPCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYG 232
            .|.|||:||||...||. .|.|.:.|..:|.|.....:.|::.:.|.:..::..|..||::||||
Zfish   164 TCSGTDLNRNFYANWGM-VGISRNCCSEVYNGATALSEPEAEAVTDFLGAHQNHLLCYLTIHSYG 227

  Fly   233 NYFLLPWGYTSDFPDTYQDMMSVADAGAKAIIYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNA 297
            ...|:|:|:.:.....|.::|.|..|.||||.......|..||:..||||.||.:.||| .::..
Zfish   228 QLILVPYGHPNISAPNYDELMEVGLAAAKAIKAVHGKSYKVGSSPDVLYPNSGSSRDFA-RLIGI 291

  Fly   298 TVAMTMELPAAGFQGFDPWISQIERLVTESWVGVRAM 334
            ..:.|.||...|..||.....||:....|::.|..::
Zfish   292 PYSFTFELRDEGQHGFILPEDQIQPTCQEAYEGAMSI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 98/297 (33%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 98/297 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593454
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.