DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32344 and CG9630

DIOPT Version :9

Sequence 1:NP_612028.4 Gene:CG32344 / 326208 FlyBaseID:FBgn0052344 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_649777.1 Gene:CG9630 / 40974 FlyBaseID:FBgn0037561 Length:613 Species:Drosophila melanogaster


Alignment Length:633 Identity:180/633 - (28%)
Similarity:292/633 - (46%) Gaps:115/633 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEKLQRREP-----TKGARALILSP 117
            |::..||:|...|||:|..:||.|.|.||||||..||:|:.|.||||..     .|...||::||
  Fly    26 GFQQMTPVQTAAIPLLLARKDVSAEAVTGSGKTLAFLVPMLEILQRRHKETPWGPKEIGALVISP 90

  Fly   118 TRELAVQTYKFIKE-LGRFME------LKSILVLGGDSMDSQFSAI-HTCPDVIVATPGRFLHLC 174
            |||||.|    |.| |.:|:|      |...|::||:|::...:.: ...|.::|.||||...|.
  Fly    91 TRELARQ----ISEVLAQFLEHEDLEHLNQQLIVGGNSIEEDIATLRRETPCILVCTPGRLEDLF 151

  Fly   175 ------VEMDLKLNSIEYVVFDEADRLFEMGFGEQLNETLHRLPSSRQTVMFSATLPKLLVEFAR 233
                  :.:..::.|:|::|.||||||.::||...:|..|..||..|:|.:||||....:.:..|
  Fly   152 QRKGDDLNLAAQVKSLEFLVLDEADRLLDLGFKTSVNNILGYLPRQRRTGLFSATQTTEVTDLIR 216

  Fly   234 AGLNDPVLIRLDVESKLPDALALKFLY--CRPDDRYTALVVLLKYVIPVQSQTVVF----AGTQH 292
            |||.:|||:.:..::.:.....|:..|  ..|:.::.||:..|.....|..:.:||    |..::
  Fly   217 AGLRNPVLVSVKEKAS
VNTPARLQNFYRIVEPELKFVALLEFLSSPATVIGKVMVFFPTCACVEY 281

  Fly   293 HVELISYILTEAGISNASVYSSLDPAARKINTAKFVNKKVSVLIVTDVAARGIDIPSLDFVVNLH 357
            ..|.:..:|.:..:  ..::..:......: ..||.|...:||:.|||.|||:|:|.:::||...
  Fly   282 WAEALPPLLPKRTV--LGIHGKMKNKRANV-VEKFRNTPQAVLLCTDVLARGLDVPEIEWVVQWD 343

  Fly   358 FPGKPKLFVHRVGRCARAGRTGTA--YSIVSTDDTAHLLDLHLFLNRPFNIHDSSALGTIPQDLL 420
            .|.....|||||||.||.|..|.|  :.:.|.|...|.|.    :|:...:          ..||
  Fly   344 PPSTASSFVHRVGRTARQGNEGNALVFLLPSEDAYVHFLK----INQKVEL----------TKLL 394

  Fly   421 EEEHLTVTDIKKSHHIAGVLRTSENAYKKYLSSRPVASTDANARVKKIKFF------ALKPLEDF 479
            .||.......||.  :..||   :..::...:.:.|......|.|..::.:      |:..|:|.
  Fly   395 TEEAEDADREKKK--LPAVL---DQLHRLQAADKGVYDKGMRAFVSHVRAYTKHECSAILRLKDL 454

  Fly   480 FTAAPVLAQAAEASGQSTESQAKVSAAERKLQEEKHDILVKMRSFRPGGTV---FELN---TTQK 538
                               ...|::.|...||..:   :.::::::.||.|   ||::   .|.|
  Fly   455 -------------------DLGKMATAYGLLQLPR---MPELKNYQGGGYVAPAFEVDLSKLTYK 497

  Fly   539 STQFIVMKEKRM-------------QHAEVINKFRQ-QRAEEDIDEEKKTIEALNPSSGRMPTAD 589
            :.|...:::|:|             ||.:.:..:.| ::|:.|...:|:..:|   ...|...|:
  Fly   498 NAQKEQVRQKKMETYEQTGSWPGQKQHKKRVESWDQTKKAKLDAKSKKELRKA---KKQRKKAAE 559

  Fly   590 EEAISSTFNKVVAPKRLQ----NMDALYKD---KPKKKKRKINSKDED 630
            .||..|...|    ||.|    ::|.|..|   ..:.||.||:.:|.|
  Fly   560 AEASRSGKGK----KRQQFSQEDLDELASDIRLFKRLKKNKISEEDFD 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32344NP_612028.4 DEADc 41..243 CDD:238167 82/203 (40%)
DEXDc 54..243 CDD:214692 82/203 (40%)
HELICc 263..384 CDD:238034 38/126 (30%)
DBP10CT 666..721 CDD:285373
CG9630NP_649777.1 DEADc 6..226 CDD:238167 82/203 (40%)
DEXDc 22..232 CDD:214692 82/209 (39%)
HELICc 239..370 CDD:238034 40/133 (30%)
DUF4217 411..470 CDD:290667 12/80 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.