DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32344 and Rm62

DIOPT Version :9

Sequence 1:NP_612028.4 Gene:CG32344 / 326208 FlyBaseID:FBgn0052344 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster


Alignment Length:375 Identity:105/375 - (28%)
Similarity:190/375 - (50%) Gaps:10/375 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FQSMGLGFELIKGITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEKLQRRE 105
            |..:.|...::|.|.::|||.||.||.:..|:.:.|.:.|.:||||||||..:::|....:..::
  Fly   283 FSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQ 347

  Fly   106 PTK---GARALILSPTRELAVQTYKFIKELGRFMELKSILVLGGDSMDSQFSAIHTCPDVIVATP 167
            |.:   |..||:|:||||||.|..:...|.|....:::..|.||.....|...:....::::|||
  Fly   348 PLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATP 412

  Fly   168 GRFLHLCVEMDLKLNSIEYVVFDEADRLFEMGFGEQLNETLHRLPSSRQTVMFSATLPKLLVEFA 232
            ||.:.........|....|:|.|||||:.:|||..|:.:.:.::...|||:|:|||.||.:.:.|
  Fly   413 GRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLA 477

  Fly   233 RAGLNDPVLIRL-DVESKLPDALALKFLYCRPDDRYTALVVLLKYVIPVQ---SQTVVFAGTQHH 293
            ...|.:.:.|.: .:|......:......|....:...|..||..:....   .:.::|..|:..
  Fly   478 EDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRR 542

  Fly   294 VELISYILTEAGISNASVYSSLDPAARKINTAKFVNKKVSVLIVTDVAARGIDIPSLDFVVNLHF 358
            |:.:...:...|:...:::.....:.|.....:|.:.|.::|:.|||||||:|:..:.:|:|..:
  Fly   543 VDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDY 607

  Fly   359 PGKPKLFVHRVGRCARAGRTGTAYSIVSTDDTAH---LLDLHLFLNRPFN 405
            |...:.::||:||..|:...||:::..:.::...   |:|:....|:..|
  Fly   608 PQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEIN 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32344NP_612028.4 DEADc 41..243 CDD:238167 69/204 (34%)
DEXDc 54..243 CDD:214692 66/191 (35%)
HELICc 263..384 CDD:238034 29/123 (24%)
DBP10CT 666..721 CDD:285373
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 104/372 (28%)
DEADc 283..488 CDD:238167 69/204 (34%)
HELICc 499..633 CDD:238034 30/133 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.