DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32344 and CG9253

DIOPT Version :9

Sequence 1:NP_612028.4 Gene:CG32344 / 326208 FlyBaseID:FBgn0052344 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_610090.1 Gene:CG9253 / 35379 FlyBaseID:FBgn0032919 Length:507 Species:Drosophila melanogaster


Alignment Length:490 Identity:155/490 - (31%)
Similarity:247/490 - (50%) Gaps:34/490 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKQADEIPGFPSLDNDA---GTSDRGADILKSKSKKNKSGGFQSMGLGFELIKGITKRGYKVPTP 64
            ::|.||.......|::|   |..|:|::...::.:|..   ::.:||...|.:...:..:|.|:.
  Fly    25 EEQEDEDNNHKEGDSEAALSGEDDKGSEDDAAEEQKLT---WKDLGLNEALCQACDELKWKAPSK 86

  Fly    65 IQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEKLQRREPTKGARALILSPTRELAVQTYKFI 129
            |||:.||:.|:|:||:.:|:||||||..|.:|:...|  .|..:...||:|:||||||.|..:..
  Fly    87 IQREAIPVALQGKDVIGLAETGSGKTGAFALPILHAL--LENPQRYFALVLTPTRELAFQIGEQF 149

  Fly   130 KELGRFMELKSILVLGGDSMDSQFSAIHTCPDVIVATPGRFL-HLCVEMDLKLNSIEYVVFDEAD 193
            :.||..:.:|..:|:||..|.:|...:...|.:|:|||||.: ||.......|.:|:|:|.||||
  Fly   150 EALGSGIGIKCCVVVGGMDMVAQGLQLAKKPHIIIATPGRLVDHLENMKGFNLKAIKYLVMDEAD 214

  Fly   194 RLFEMGFGEQLNETLHRLPSSRQTVMFSATLPKLLVEFARAGLNDPVLIRLDVESKLPDALALKF 258
            |:..|.|..:|::.|..||..|:|.:||||:.|.:.:..||.|.|||.:.:..:.:..:.|...:
  Fly   215 RILNMDFEVELDKILKVLPRERRTFLFSATMTKKVKKLQRASLKDPVKVEVSNKYQTVEQLQQSY 279

  Fly   259 LYCRPDDRYTALVVLLKYVIPVQSQTVVFAGTQHHVELISYILTEAGISNASVYSSLDPAARKIN 323
            |:.....:...||.:|..:  ..:..::|..|.::....:.:|...|::...::..:....|...
  Fly   280 LFIPVKYKDVYLVHILNEL--AGNSFMIFCSTCNNTVKTALMLRALGLAAIPLHGQMSQNKRLAA 342

  Fly   324 TAKFVNKKVSVLIVTDVAARGIDIPSLDFVVNLHFPGKPKLFVHRVGRCARAGRTGTAYSIVSTD 388
            ..||..|..|:||.||||:||:|||.:|.|||...|...|.::|||||.|||||:|.|.::||..
  Fly   343 LNKFKAKNRSILISTDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITLVSQY 407

  Fly   389 D------TAHLLDLHLFLNRPFNIHDSSALGTIPQDLLEEEHLT-------VTDIKKSHHIAGVL 440
            |      ..|||...|.|   :...:...:..  |:.:.|...|       :.|.:..|...|..
  Fly   408 DIELYQRIEHLLGKQLTL---YKCEEDEVMAL--QERVAEAQRTAKLELKDLEDTRGGHKRGGDT 467

  Fly   441 R-TSENAYKKYLSSRPVASTDANARVKKIKFFALK 474
            . .|||........:|:..|....|    |.|..|
  Fly   468 HDDSENFTGARKRMKPMGGTGGGGR----KSFGKK 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32344NP_612028.4 DEADc 41..243 CDD:238167 80/202 (40%)
DEXDc 54..243 CDD:214692 77/189 (41%)
HELICc 263..384 CDD:238034 41/120 (34%)
DBP10CT 666..721 CDD:285373
CG9253NP_610090.1 SrmB 34..498 CDD:223587 151/479 (32%)
DEADc 63..264 CDD:238167 80/202 (40%)
HELICc 274..403 CDD:238034 43/130 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.