DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32344 and CG10333

DIOPT Version :9

Sequence 1:NP_612028.4 Gene:CG32344 / 326208 FlyBaseID:FBgn0052344 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_609888.2 Gene:CG10333 / 35112 FlyBaseID:FBgn0032690 Length:822 Species:Drosophila melanogaster


Alignment Length:462 Identity:139/462 - (30%)
Similarity:226/462 - (48%) Gaps:57/462 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DNDAGTSDRGADILKSKSKKNKSGG--------FQSMGLGFELIKGITKRGYKVPTPIQRKTIPL 72
            :||..| :|...|.:........||        :...|...|:|..|.|.|||.||||||:.||:
  Fly   364 ENDEMT-ERDWRIFREDYNVTIKGGRIPNPIRSWNESGFPKEIIDIIDKVGYKEPTPIQRQAIPI 427

  Fly    73 ILEGRDVVAMAKTGSGKTACFLIPLFE------KLQRREPT-KGARALILSPTRELAVQTYKFIK 130
            .|:.||::.:|:||||||..|||||..      |::|.|.. :|..|:|::||||||.|..:...
  Fly   428 GLQNRDIIGVAETGSGKTLAFLIPLLSWIQSLPKIERLEDVDQGPYAIIMAPTRELAQQIEEETT 492

  Fly   131 ELGRFMELKSILVLGGDSMDSQFSAIHTCPDVIVATPGRFLHLCVEMDLKLNSIEYVVFDEADRL 195
            :.|:.:.:::::|:||.|.:.|...:....::::|||||.:.:.....|.||...|:|.|||||:
  Fly   493 KFGQPLGIRTVVVVGGLSREEQGFRLRLGCEIVIATPGRLIDVLENRYLVLNQCTYIVLDEADRM 557

  Fly   196 FEMGFGEQLNETLHRLPSS-------------------------RQTVMFSATLPKLLVEFARAG 235
            .:|||...:.:.|..:|.:                         ||||||:||:|..:...||..
  Fly   558 IDMGFEPDVQKILEYMPVTNLKPDTEEAEDETKLMENFYTKKKYRQTVMFTATMPPAVERLARTY 622

  Fly   236 LNDPVLIRLDVESKLPDALALKFLYC--RPDDRYTALVVLLKYVIPVQSQTVVFAGTQHHVELIS 298
            |..|..:.:....| |.....:.:|.  ..|.|...:.:|.:.:.|   ..::|...:...::::
  Fly   623 LRRPATVYIGSVGK-PTERTEQIVYMMGENDKRKKLMEILSRKIDP---PVIIFVNQKKGADVLA 683

  Fly   299 YILTEAGISNASVYSSLDPAARKINTAKFVNKKVSVLIVTDVAARGIDIPSLDFVVNLHFPGKPK 363
            ..|.:.|.::.:::.......|:...|...:....:|:.||||.|||||..:..|:|.......:
  Fly   684 KGLEKLGYNSCTLHGGKGQEQREYALAALKSGAKDILVATDVAGRGIDIKDVSLVINYDMAKTIE 748

  Fly   364 LFVHRVGRCARAGRTGTAYSIVSTDDTAHLLDLHLFLNRPFNIHDSSALGTIPQDLL---EEEHL 425
            .:.||:||..|||:||.|.|.|:.||:|...||...::       :|.:.|.|.:|:   |.:|.
  Fly   749 DYTHRIGRTGRAGKTGCAISFVTKDDSALFYDLKQCVS-------ASPVSTCPPELMNHPEAQHK 806

  Fly   426 TVTDIKK 432
            ..|.:.|
  Fly   807 PGTVVTK 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32344NP_612028.4 DEADc 41..243 CDD:238167 83/233 (36%)
DEXDc 54..243 CDD:214692 80/220 (36%)
HELICc 263..384 CDD:238034 31/120 (26%)
DBP10CT 666..721 CDD:285373
CG10333NP_609888.2 DEADc 396..629 CDD:238167 83/232 (36%)
DEXDc 409..632 CDD:214692 80/222 (36%)
Helicase_C 651..761 CDD:278689 26/112 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.