DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32344 and eIF4A

DIOPT Version :9

Sequence 1:NP_612028.4 Gene:CG32344 / 326208 FlyBaseID:FBgn0052344 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster


Alignment Length:383 Identity:115/383 - (30%)
Similarity:199/383 - (51%) Gaps:28/383 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FQSMGLGFELIKGITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEKLQR-- 103
            |..|.|..||::||...|::.|:.||::.|...:.||||:|.|::|:||||.|.|.:.:::..  
  Fly    32 FDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSI 96

  Fly   104 REPTKGARALILSPTRELAVQTYKFIKELGRFMELKSILVLGGDSMDSQFSAIHTCPDVIVATPG 168
            ||    .:||||:||||||.|..:.:..||.:|::.|...:||.::......:.:...|:|.|||
  Fly    97 RE----CQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPG 157

  Fly   169 RFLHLCVEMDLKLNSIEYVVFDEADRLFEMGFGEQLNETLHRLPSSRQTVMFSATLPKLLVEFAR 233
            |...:.....|:...|:..|.||||.:...||.:|:.:....||...|.::.|||:|..::|.:|
  Fly   158 RVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSR 222

  Fly   234 AGLNDPVLIRLDVESKLPDALALKFLYCRPD--------DRYTALVVLLKYVIPVQSQTVVFAGT 290
            ..:.|||.|.:..|....:.:...::..:.:        |.|..|.:         :|:|:|..|
  Fly   223 CFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSI---------TQSVIFCNT 278

  Fly   291 QHHVELISYILTEAGISNASVYSSLDPAARKINTAKFVNKKVSVLIVTDVAARGIDIPSLDFVVN 355
            :..|:.::..::....:.::::..::...|::...:|.:....|||.||:.|||||:..:..|:|
  Fly   279 RRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVIN 343

  Fly   356 LHFPGKPKLFVHRVGRCARAGRTGTAYSIVSTDDTAHLLDLHLFLN-----RPFNIHD 408
            ...|...:.::||:||..|.||.|.|.:.::.||...|.|:..|.:     .|.||.|
  Fly   344 YDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIAD 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32344NP_612028.4 DEADc 41..243 CDD:238167 72/203 (35%)
DEXDc 54..243 CDD:214692 66/190 (35%)
HELICc 263..384 CDD:238034 32/128 (25%)
DBP10CT 666..721 CDD:285373
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 115/383 (30%)
DEADc 32..232 CDD:238167 72/203 (35%)
Helicase_C 254..358 CDD:278689 25/112 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.