DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32344 and mahe

DIOPT Version :9

Sequence 1:NP_612028.4 Gene:CG32344 / 326208 FlyBaseID:FBgn0052344 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001284994.1 Gene:mahe / 31707 FlyBaseID:FBgn0029979 Length:945 Species:Drosophila melanogaster


Alignment Length:372 Identity:118/372 - (31%)
Similarity:192/372 - (51%) Gaps:20/372 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FQSMGLGFELIKGITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEKLQRRE 105
            |:...|...:|:.:.::|:..||.||.:..|:.|.|||:|.:|:||||||..:::|....:..:.
  Fly   239 FEESSLPAHVIEEMKRQGFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQP 303

  Fly   106 PT---KGARALILSPTRELAVQTYKFIKELGRFM--ELKSILVLGGDSMDSQFSAIHTCPDVIVA 165
            |.   :|..||:|:||||||.|....:::.|...  |::...:.||.|...|...:....:||:|
  Fly   304 PIIRGEGPIALVLAPTRELAQQIQSVVRDYGHLCKPEIRHTCIFGGSSKVPQARDLDRGVEVIIA 368

  Fly   166 TPGRFLHLCVEMDLKLNSIEYVVFDEADRLFEMGFGEQLNETLHRLPSSRQTVMFSATLPKLLVE 230
            ||||.:......:..|....|:|.|||||:.:|||..|:.:.:.::...||.||:|||.||.:..
  Fly   369 TPGRLIDFLENRNTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQA 433

  Fly   231 FARAGLNDPVLI-----RLDVESKLPDALALKFLYCRPDDRYTALVVLLKYVIPVQ------SQT 284
            .|...|||.:.|     .|.....:...:.:    |...::...||.||..:.|::      ::.
  Fly   434 LAGDFLNDYIQINIGSMNLSANHNIRQIVEI----CTEIEKPQRLVCLLNEISPIKNSGNNGNKI 494

  Fly   285 VVFAGTQHHVELISYILTEAGISNASVYSSLDPAARKINTAKFVNKKVSVLIVTDVAARGIDIPS 349
            :||..|:..||.|..|:...|.:..|::.......|......|.|.|.::||.||||:||:|:..
  Fly   495 IVFVETKIKVEDILQIIRAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVED 559

  Fly   350 LDFVVNLHFPGKPKLFVHRVGRCARAGRTGTAYSIVSTDDTAHLLDL 396
            |.:|:|..:|...:.:|||:||..|..:.||||:..:.|:.....:|
  Fly   560 LQYVINYDYPNSSENYVHRIGRTGRCQQLGTAYTFFTPDNAKQAREL 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32344NP_612028.4 DEADc 41..243 CDD:238167 73/211 (35%)
DEXDc 54..243 CDD:214692 70/198 (35%)
HELICc 263..384 CDD:238034 41/126 (33%)
DBP10CT 666..721 CDD:285373
maheNP_001284994.1 PTZ00110 136..656 CDD:240273 118/372 (32%)
DEADc 239..446 CDD:238167 72/206 (35%)
HELICc 457..594 CDD:238034 42/140 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.