powered by:
Protein Alignment Drsl1 and Drsl6
DIOPT Version :9
Sequence 1: | NP_728872.1 |
Gene: | Drsl1 / 326207 |
FlyBaseID: | FBgn0052274 |
Length: | 69 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_728873.1 |
Gene: | Drsl6 / 38416 |
FlyBaseID: | FBgn0052268 |
Length: | 72 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 43/71 - (60%) |
Similarity: | 53/71 - (74%) |
Gaps: | 2/71 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MEIKFLIVLSAVLMIIFLGAEESHADCLSGRYRGSCAVWHRKKCVDICQRE--GRTSGHCSPSLK 63
|:||||....|:||::.|||:|:.||||||||||.||||..:.|..:|:.| ||.|||||..|:
Fly 2 MQIKFLFTFLALLMMVILGAKEADADCLSGRYRGPCAVWDNETCRRVCREEGRGRVSGHCSARLQ 66
Fly 64 CWCEGC 69
||||||
Fly 67 CWCEGC 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45448662 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0008543 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.