DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drsl1 and Drsl2

DIOPT Version :10

Sequence 1:NP_728872.1 Gene:Drsl1 / 326207 FlyBaseID:FBgn0052274 Length:69 Species:Drosophila melanogaster
Sequence 2:NP_728860.2 Gene:Drsl2 / 38408 FlyBaseID:FBgn0052279 Length:70 Species:Drosophila melanogaster


Alignment Length:69 Identity:42/69 - (60%)
Similarity:51/69 - (73%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEIKFLIVLSAVLMIIFLGAEESHADCLSGRYRGSCAVWHRKKCVDICQREGRTSGHCSPSLKCW 65
            ::||||.|..||:.|:.|.|..:.||||||:|:|.||||..:.|..||:.||..|||||||||||
  Fly     2 VQIKFLFVFLAVMTIVVLAANMADADCLSGKYKGPCAVWDNEMCRRICKEEGHISGHCSPSLKCW 66

  Fly    66 CEGC 69
            ||||
  Fly    67 CEGC 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drsl1NP_728872.1 Gamma-thionin 26..68 CDD:395240 28/41 (68%)
Drsl2NP_728860.2 Gamma-thionin 27..69 CDD:395240 28/41 (68%)

Return to query results.
Submit another query.