DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drsl1 and Drsl3

DIOPT Version :9

Sequence 1:NP_728872.1 Gene:Drsl1 / 326207 FlyBaseID:FBgn0052274 Length:69 Species:Drosophila melanogaster
Sequence 2:NP_728861.1 Gene:Drsl3 / 317955 FlyBaseID:FBgn0052283 Length:71 Species:Drosophila melanogaster


Alignment Length:70 Identity:32/70 - (45%)
Similarity:44/70 - (62%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEIKFLIVLSAVLMIIFLGAEESHA-DCLSGRYRGSCAVWHRKKCVDICQREGRTSGHCSPSLKC 64
            :::.||..:.||:.|:.:.|....| |||||.:.|.|..|..:||..:|..||..|||||.::||
  Fly     2 VQMIFLFAILAVMTIVLMEANTVLARDCLSGTFGGPCWAWSGEKCRRLCIEEGHVSGHCSGAMKC 66

  Fly    65 WCEGC 69
            |||||
  Fly    67 WCEGC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drsl1NP_728872.1 Gamma-thionin 24..68 CDD:278720 23/44 (52%)
Drsl3NP_728861.1 Gamma-thionin 28..70 CDD:278720 22/41 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008543
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.