DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL1B and ttl

DIOPT Version :9

Sequence 1:NP_729025.1 Gene:TTLL1B / 326203 FlyBaseID:FBgn0052238 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_005156750.1 Gene:ttl / 767687 ZFINID:ZDB-GENE-060929-608 Length:404 Species:Danio rerio


Alignment Length:355 Identity:95/355 - (26%)
Similarity:153/355 - (43%) Gaps:79/355 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 QMINHFPNHYELSRKDLLVKNIKR-----------------YRKDLERDGNPLAEKT------ES 172
            |::|::....:|.||..|||.||.                 |..:|   ..|:|..|      :|
Zfish    64 QLVNYYRGADKLCRKASLVKIIKTSPELKDSCNWFPESYIIYPTNL---NTPVAPATNGISHMKS 125

  Fly   173 NNSSGTRYLYLDFVPTTFVLPADYNMFVEEYRKFPLSTWIMKPCGKSQGAGIFLINKLSKLKKWS 237
            |..:..|.::|          |.||...|....   :.||.|....::||||.:.:..::|.::.
Zfish   126 NPKTDEREVFL----------ASYNSRKESGDG---TVWIAKSSAGAKGAGILISHDANQLLEFI 177

  Fly   238 REAKGPFHPQIAKESYVISRYIDNPLLI--GGKKFDLRLYVLVASFRPLKAYLFKQGFCRFCTVK 300
             :.:|..|        ||.:|::.|||:  |.:|||:|.:|||.  .....||:::|..|..:..
Zfish   178 -DNQGQVH--------VIQKYLEKPLLLEPGHRKFDIRSWVLVD--HQYNIYLYREGVLRTSSEP 231

  Fly   301 YDTSVTELDNMYVHLTNVSVQK-HGGEYNTL-HGGKWSVQNLALYLEGTRGKEVTDRLFGAISWL 363
            |::|  :|.||..||||..:|| |...|... .|.:........||..|....:...:...|..:
Zfish   232 YNSS--DLQNMTSHLTNHCIQKEHSQNYGRYEEGNEMFFDEFKQYLLNTHNLAMETSILPQIKHI 294

  Fly   364 IVHSLRAVAPVMASDRH----CFECYGYDIIIDNALKPWLVEVNASPSLTSTTVNDRILKYKLID 424
            |...|..:.|.: |.:|    .|:.:|:|.::|.:.|.||:|:|.:|:...          ||..
Zfish   295 IRSCLACIEPAI-STKHLSYQSFQLFGFDFMLDESFKVWLIEINGAPACAQ----------KLYP 348

  Fly   425 NILSVVLPPDGVPDVRWNKV--PSADALGN 452
            .:.      .|:.||..:.|  .|||||.:
Zfish   349 ELC------QGIVDVAISTVFSLSADALSS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL1BNP_729025.1 TTL 126..438 CDD:281171 87/337 (26%)
ttlXP_005156750.1 TTL 85..363 CDD:281171 81/323 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1567
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.