DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL1B and TTLL3A

DIOPT Version :9

Sequence 1:NP_729025.1 Gene:TTLL1B / 326203 FlyBaseID:FBgn0052238 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_609069.1 Gene:TTLL3A / 33947 FlyBaseID:FBgn0031854 Length:992 Species:Drosophila melanogaster


Alignment Length:260 Identity:81/260 - (31%)
Similarity:131/260 - (50%) Gaps:43/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 WIMKPCGKSQGAGIFLINKLSKLKKWSREAKGPFHPQIAKES-YVISRYIDNPLLIGGKKFDLRL 274
            ||:||..|.:|.||.|::.|.|:       .|..:..||.:| ||:.:||:.||::...|||:|.
  Fly   418 WIVKPANKCRGRGIILMDNLKKI-------LGVVNLSIASKSRYVVQKYIERPLILFQTKFDIRQ 475

  Fly   275 YVLVASFRPLKAYLFKQGFCRFCTVKYDTSVTELDNMY--VHLTNVSVQKHGGEYNTLHGGK--- 334
            :.|:.:.:||..:.:::.:.||.:.:|     .|.|.:  |||||.::||   :|.   .||   
  Fly   476 WFLITNTQPLVVWFYRESYLRFSSQEY-----SLSNHHESVHLTNYAIQK---KYT---NGKRDK 529

  Fly   335 -------WSVQNLALYLEGTRGK--EVTDRLFGAISWLIVHSLRAVAPVMASDRHCFECYGYDII 390
                   |...:...||... ||  ...:|:|..:...||..:.|....|....:.||.:|.|.:
  Fly   530 RLPSENMWDCYSFQAYLRQI-GKYNMWLERIFPGMRKAIVGCMLASQENMDRRPNTFELFGADFM 593

  Fly   391 IDNALKPWLVEVNASPSLTSTTVNDRILKYKLIDNILSVVLPPDGVPDVRWNKVPSADALGNFEL 455
            |.....|||:|:|:||.|.:||.....:..:.:::::.||:      |.|.:  |.|: ||||||
  Fly   594 ICENFYPWLIEINSSPDLGATTSVTARMCPQCLEDVVKVVI------DRRTD--PKAE-LGNFEL 649

  Fly   456  455
              Fly   650  649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL1BNP_729025.1 TTL 126..438 CDD:281171 71/241 (29%)
TTLL3ANP_609069.1 TTL 342..640 CDD:281171 73/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450513
Domainoid 1 1.000 75 1.000 Domainoid score I2480
eggNOG 1 0.900 - - E1_KOG2157
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.