DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL1B and Ttll13

DIOPT Version :9

Sequence 1:NP_729025.1 Gene:TTLL1B / 326203 FlyBaseID:FBgn0052238 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001128434.1 Gene:Ttll13 / 308762 RGDID:1310399 Length:825 Species:Rattus norvegicus


Alignment Length:355 Identity:109/355 - (30%)
Similarity:167/355 - (47%) Gaps:63/355 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GWHQVNGDDDWHFYWAGVQTCRNIFSVDSGYRMHDNQMINHFPNHYELSRKDLLVKNIKRYRKDL 159
            |..:|..|::|..||.....     |::....|...|.|||||...|:.|||||.:|:.|.:|  
  Rat   108 GLKEVGEDEEWTVYWTDCSV-----SLERVMDMKRFQKINHFPGMTEICRKDLLARNLNRMQK-- 165

  Fly   160 ERDGNPLAEKTESNNSSGTRYLYLDFVPTTFVLPADYNMFVEEYRKFPLSTWIMKPCGKSQGAGI 224
                   ...||.|           ..|.|:.|||||..|....|:....|:|.||....||.||
  Rat   166 -------LYPTEYN-----------IFPRTWCLPADYGDFQAYGRQRKTRTYICKPDSGCQGRGI 212

  Fly   225 FLINKLSKLKKWSREAKGPFHPQIAKESYVISRYIDNPLLIGGKKFDLRLYVLVASFRPLKAYLF 289
            |:.....::|              ..|..:..:||..|.||.|.|||:|:|||:.|..||:.:::
  Rat   213 FITRTPKEIK--------------PGEHMICQQYITKPFLIDGFKFDMRIYVLITSCDPLRIFMY 263

  Fly   290 KQGFCRFCTVKY-DTSVTELDNMYVHLTNVSVQKHGGEY--NTLHGGKWSVQNLALYLEGTRGKE 351
            ::|..||.|:.| :.|...|:.:.:||||.::.||...:  :...|.|..:..|..:|.  ....
  Rat   264 EEGLARFATMPYVEPSHNNLEEVCMHLTNYAINKHNENFVRDDAVGSKRKLSTLNAWLR--EHSH 326

  Fly   352 VTDRLFGAISWLIVHSLRAVAPVMASDRH----------------CFECYGYDIIIDNALKPWLV 400
            ....|:|.|..:|:.::.:...|:   ||                |||..|:||::|:.|||||:
  Rat   327 DPRELWGDIEDIIIKTIISAHSVL---RHNYRTCFPQYLCGGTCACFEILGFDILLDHKLKPWLL 388

  Fly   401 EVNASPSLTSTTVNDRILKYKLIDNILSVV 430
            |||.|||.|:.:..||.:|..|:.:.::::
  Rat   389 EVNHSPSFTTDSRLDREVKDALLCDAMNLI 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL1BNP_729025.1 TTL 126..438 CDD:281171 102/324 (31%)
Ttll13NP_001128434.1 TTL 133..416 CDD:281171 102/321 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.