DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL1B and Ttl

DIOPT Version :9

Sequence 1:NP_729025.1 Gene:TTLL1B / 326203 FlyBaseID:FBgn0052238 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_612545.2 Gene:Ttl / 171572 RGDID:621113 Length:377 Species:Rattus norvegicus


Alignment Length:383 Identity:97/383 - (25%)
Similarity:162/383 - (42%) Gaps:77/383 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 YWAGVQTCRNIFSVDSGYRM--------HD---NQMINHFPNHYELSRKDLLVKNIKR------- 154
            ||..::.....|::..|.|.        |:   .|::|::....:|.||..|||.:|.       
  Rat    26 YWKRLRRDNPRFNLMLGERNRLPFGRLGHEPGLAQLVNYYRGADKLCRKASLVKLVKTSPELSES 90

  Fly   155 ----------YRKDLERDGNPLAEKTE---SNNSSGTRYLYLDFVPTTFVLPADYNMFVEEYRKF 206
                      |..:|:....|.....:   ||:.:..|..:|          |.||...|:... 
  Rat    91 CSWFPESYVIYPTNLKTPVAPAQNGIQLPVSNSRTDEREFFL----------ASYNRKKEDGEG- 144

  Fly   207 PLSTWIMKPCGKSQGAGIFLINKLSKLKKWSREAKGPFHPQIAKESYVISRYIDNPLLI--GGKK 269
              :.||.|....::|.||.:.::.|:|..:. :.:|..|        ||.:|:::|||:  |.:|
  Rat   145 --NVWIAKSSAGAKGEGILISSEASELLDFI-DNQGQVH--------VIQKYLEHPLLLEPGHRK 198

  Fly   270 FDLRLYVLVASFRPLKAYLFKQGFCRFCTVKYDTSVTELDNMYVHLTNVSVQ----KHGGEYNTL 330
            ||:|.:|||.  .....||:::|..|..:..|  .|....:...||||..:|    |:.|:|.  
  Rat   199 FDIRSWVLVD--HQYNIYLYREGVLRTASEPY--HVDNFQDKTCHLTNHCIQKEYSKNYGKYE-- 257

  Fly   331 HGGKWSVQNLALYLEGTRGKEVTDRLFGAISWLIVHSLRAVAPVMASDRH----CFECYGYDIII 391
            .|.:...:....||.......:.:.:...|..:|...|.:|.|.: |.:|    .|:..|:|.::
  Rat   258 EGNEMFFEEFNQYLTSALNITLENSILLQIKHIIRSCLMSVEPAI-STKHLPYQSFQLLGFDFMV 321

  Fly   392 DNALKPWLVEVNASPSLTSTTVNDRILKYKLIDNILSVVLPPDGVPDVRWNKVPSADA 449
            |..||.||:|||.:|:.......:  |...::|..:|.|.||   ||.  .:||...|
  Rat   322 DEELKVWLIEVNGAPACAQKLYAE--LCQGIVDIAISSVFPP---PDT--EQVPQQPA 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL1BNP_729025.1 TTL 126..438 CDD:281171 88/352 (25%)
TtlNP_612545.2 TTL 81..366 CDD:397308 80/320 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.