DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL1B and Ttll2

DIOPT Version :9

Sequence 1:NP_729025.1 Gene:TTLL1B / 326203 FlyBaseID:FBgn0052238 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_011244473.1 Gene:Ttll2 / 100216474 MGIID:3644030 Length:551 Species:Mus musculus


Alignment Length:371 Identity:124/371 - (33%)
Similarity:185/371 - (49%) Gaps:75/371 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LDKSVLVNNFEKRGW----HQVNGDDDWHFYWAGVQTCRNIFSVDSGYRMHDN------QMINHF 136
            |.:|||:    :|||    .|....:||:.||.           .|.:|..:.      |.:||.
Mouse    66 LVQSVLL----ERGWDKFDEQRQDVEDWNLYWR-----------SSSFRRAEYVNVKPWQRLNHH 115

  Fly   137 PNHYELSRKDLLVKNIKRYRKDLERDGNPLAEKTESNNSSGTRYLYLDFVPTTFVLPADYNMFVE 201
            |....|:|||.|.|::.|.|   .|.|..|.|                |.|.||::|.||..||.
Mouse   116 PGMTNLTRKDCLAKHLARMR---SRYGESLYE----------------FTPLTFIMPTDYTKFVA 161

  Fly   202 EY--RKFPLST----WIMKPCGKSQGAGIFLINKLSKLKKWSREAKGPFHPQIAKESYVISRYID 260
            :|  .|..|.|    ||.||...|:|.||.:.:.:..|              :.|.:||:.:||.
Mouse   162 KYFKEKQDLGTKPSYWICKPAELSRGRGIIIFSDIRDL--------------MFKGTYVVQKYIC 212

  Fly   261 NPLLIGGKKFDLRLYVLVASFRPLKAYLFKQGFCRFCTVKYDTSVTELDNMYVHLTNVSVQKHGG 325
            ||||:|..|.|||:||.:..|:||..|::::|..||.|.|:|  :..|::.|.||||.|:.|.|.
Mouse   213 NPLLVGRYKCDLRIYVCITGFKPLTIYMYQEGLVRFATEKFD--LRNLEDYYSHLTNSSINKLGA 275

  Fly   326 EYNTL-----HGGKWSVQNLALYLEGTRGKEVTDRLF-GAISWLIVHSLRAVAPVMASDRHCFEC 384
            .|..:     .|.||::.....||   |..:|.|.|. ..||.:::.::.|:||.:....:|||.
Mouse   276 SYQKIKEVVGQGCKWTLSRFFSYL---RNWDVDDLLLRQKISHMVILTVLAMAPSVPVTYNCFEL 337

  Fly   385 YGYDIIIDNALKPWLVEVNASPSLTSTTVNDRILKYKLIDNILSVV 430
            :|:||:||:.|||||:|||.:|:||.....|..:|..|:.:::.::
Mouse   338 FGFDILIDDNLKPWLLEVNYNPALTLDCSTDESVKRSLVHDVIELL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL1BNP_729025.1 TTL 126..438 CDD:281171 111/323 (34%)
Ttll2XP_011244473.1 TTL 108..381 CDD:281171 110/310 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.