DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL1B and ttll5

DIOPT Version :9

Sequence 1:NP_729025.1 Gene:TTLL1B / 326203 FlyBaseID:FBgn0052238 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_012823512.2 Gene:ttll5 / 100158545 XenbaseID:XB-GENE-5889203 Length:1128 Species:Xenopus tropicalis


Alignment Length:426 Identity:140/426 - (32%)
Similarity:214/426 - (50%) Gaps:81/426 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TD--LDKSVLVNNFEKRGWHQVNGD-DDWHFYWAGVQTCRNIFSVDSGYRMHDNQMINHFPNHYE 141
            ||  |.:|:|    ...|:.:||.: :|::..|.|.....:|....:.:     |.:||||..||
 Frog    70 TDSRLVRSIL----SAHGFQEVNANSNDFNIMWTGSHVKPHIMRSLTNF-----QKVNHFPRSYE 125

  Fly   142 LSRKDLLVKNIKRYRKDLERDGNPLAEKTESNNSSGTRYLYLDFVPTTFVLPADYNMFVEEYRKF 206
            |:|||.|.||::|.::                 |.|.:..:|  :|.|::|||:|..|...:.| 
 Frog   126 LTRKDRLYKNVQRMQQ-----------------SHGFKNFHL--LPQTYLLPAEYQDFCTAFAK- 170

  Fly   207 PLSTWIMKPCGKSQGAGIFLINKLSKLKKWSREAKGPFHPQIAKESYVISRYIDNPLLIGGKKFD 271
            ....||:||...|:|.|::|||..|.:.              .:::.::||||.|||||.|.|||
 Frog   171 DRGPWIVKPVASSRGRGVYLINSPSLIS--------------MEDNILVSRYIGNPLLIDGFKFD 221

  Fly   272 LRLYVLVASFRPLKAYLFKQGFCRFCTVKYDTSVTELDNMYVHLTNVSVQKHGGEYNTL------ 330
            :|||||:.|:.||..||:::|..||.|.|||.:...:.|.::||||.||.|..|:|.:.      
 Frog   222 VRLYVLITSYDPLVIYLYEEGLTRFATAKYDRAAKNIKNQFMHLTNYSVNKKSGDYVSCDDPDVE 286

  Fly   331 -HGGKWSVQNLALYLEGTRGKEVTDRLFGAISWLIVHSL-RAVAPVMASDR-------HCFECYG 386
             :|.|||:..:..||: ..||: |..|...:..||:.:: .|..|:.::.:       :|||.||
 Frog   287 DYGNKWSMSAMLRYLK-QDGKD-TAALMSQVEDLIIKTIVSAELPIASACKSLITHRGNCFELYG 349

  Fly   387 YDIIIDNALKPWLVEVNASPSLTSTTVNDRILKYKLIDNILSVVLPPDGV----PDVRWNKVPSA 447
            :|::||..|||||:|||.||||......|..:|..:|.::.::|    ||    |..|:.:..|:
 Frog   350 FDVLIDGNLKPWLLEVNLSPSLACDAPLDLKVKASMISDMFTLV----GVECQDPQQRFGRASSS 410

  Fly   448 DALGNFELLIDEELAAQDEQHQNSSSNTHSKTSKMG 483
                    |.|:.  .|...||...|.....|...|
 Frog   411 --------LYDKR--TQKSTHQRPLSANDIDTGLQG 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL1BNP_729025.1 TTL 126..438 CDD:281171 117/330 (35%)
ttll5XP_012823512.2 TTL 113..390 CDD:397308 114/317 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.