DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32202 and AT1G55650

DIOPT Version :10

Sequence 1:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_175961.1 Gene:AT1G55650 / 842014 AraportID:AT1G55650 Length:337 Species:Arabidopsis thaliana


Alignment Length:43 Identity:12/43 - (27%)
Similarity:16/43 - (37%) Gaps:0/43 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EQKRRGPKPKNKQAADETGAPGSEPGPNTPAARKPRKQKAKQA 120
            |.||...|.|:.|............|.|...|.:..:.||:.|
plant   196 ETKRGKKKAKSSQGDSHKPPKRQRTGYNFFVAEQSVRIKAENA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32202NP_730354.2 None
AT1G55650NP_175961.1 ARID_HMGB9-like 36..121 CDD:350636
HMG-box_AtHMGB9-like 215..281 CDD:438825 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.