DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32202 and 3xHMG-box2

DIOPT Version :10

Sequence 1:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_194111.1 Gene:3xHMG-box2 / 828480 AraportID:AT4G23800 Length:456 Species:Arabidopsis thaliana


Alignment Length:129 Identity:25/129 - (19%)
Similarity:46/129 - (35%) Gaps:39/129 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLNKKELMYKQLVEKLYDRCQRIQAENERCVMRVNGIKKIVRRRNHDVELLKRRLDKHGDDWRSV 66
            |:..:.::.|..:||  |:.:.:..|.:          :|:|::..::|                
plant    48 LMEMQTMLEKMKIEK--DKTEELLKEKD----------EILRKKEEELE---------------- 84

  Fly    67 PMEAPHPKGKTE----QKRRGPKPKNKQAADETGAPGSEPGPNTPAARKPRKQKAKQAPINPNP 126
            ..:|...|.|.|    ||.:..||....|..::....:|       ..|..|:|.|..|....|
plant    85 TRDAEQEKLKVELKKLQKMKEFKPNMTFACGQSSLTQAE-------QEKANKKKKKDCPETKRP 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32202NP_730354.2 None
3xHMG-box2NP_194111.1 PTZ00121 <2..454 CDD:173412 25/129 (19%)
HMG-box_AtHMGB6-like_rpt1 139..206 CDD:438822 1/3 (33%)
HMG-box_AtHMGB6-like_rpt2 255..320 CDD:438823
HMG-box_AtHMGB6-like_rpt3 371..447 CDD:438824
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.