DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32202 and HMGB4

DIOPT Version :10

Sequence 1:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_179347.1 Gene:HMGB4 / 816263 AraportID:AT2G17560 Length:138 Species:Arabidopsis thaliana


Alignment Length:74 Identity:19/74 - (25%)
Similarity:25/74 - (33%) Gaps:7/74 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LKRRLDKHGDDWRSVPMEAPHPKGK----TEQKRRG---PKPKNKQAADETGAPGSEPGPNTPAA 109
            ||.|..|.|...:..|.:...|...    .|..|:.   ..|.||..|....|.|:.....|...
plant    17 LKTRGRKAGKKTKKDPNQPKRPPSAFFVFLEDFRKEFNLANPNNKSVATVGKAAGARWKAMTDED 81

  Fly   110 RKPRKQKAK 118
            :.|...||:
plant    82 KAPYVAKAE 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32202NP_730354.2 None
HMGB4NP_179347.1 HMG-box_AtHMGB1-like 36..96 CDD:438821 13/55 (24%)

Return to query results.
Submit another query.