powered by:
Protein Alignment CG32202 and TFAM
DIOPT Version :9
Sequence 1: | NP_730354.2 |
Gene: | CG32202 / 326199 |
FlyBaseID: | FBgn0052202 |
Length: | 141 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_003192.1 |
Gene: | TFAM / 7019 |
HGNCID: | 11741 |
Length: | 246 |
Species: | Homo sapiens |
Alignment Length: | 127 |
Identity: | 23/127 - (18%) |
Similarity: | 44/127 - (34%) |
Gaps: | 48/127 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 KKELMYKQLVEKLYDRCQRIQAENERCVMRVNGIKKIVRRRN-HDVELLKRRLDKHGD------- 61
:||:|.|.|..|...:.:.:.. :.|..|.|: ::|.:.:|..:..||
Human 130 EKEIMDKHLKRKAMTKKKELTL-----------LGKPKRPRSAYNVYVAERFQEAKGDSPQEKLK 183
Fly 62 ----DWRSV-----PMEAPHPK--------------------GKTEQKRRGPKPKNKQAADE 94
:|::: .:...|.| |:.:..||..|.:.|..|:|
Human 184 TVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEE 245
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32202 | NP_730354.2 |
None |
TFAM | NP_003192.1 |
HMG_box |
50..117 |
CDD:395407 |
|
HMGB-UBF_HMG-box |
155..216 |
CDD:238686 |
9/60 (15%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.