DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32202 and Tfpt

DIOPT Version :10

Sequence 1:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001277310.1 Gene:Tfpt / 69714 MGIID:1916964 Length:259 Species:Mus musculus


Alignment Length:146 Identity:42/146 - (28%)
Similarity:65/146 - (44%) Gaps:32/146 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LNKKELMYKQLVEKLYDRCQRIQAENERCVMRVNGIKKIVRRRNHDVELLKRRLDKHGDDWR--- 64
            ||:::      .:.|..||:.|:..|||.:.|::.:::|.||...:...|.|.||.:|||:|   
Mouse    77 LNRRK------YQALGRRCREIEQVNERVLNRLHQVQRITRRLQQERRFLMRVLDSYGDDYRDSQ 135

  Fly    65 ---------SVPMEAPHPKGKTEQ---KRRGPKPKNKQAA--DETG-APGSEPGPNTPAARKPRK 114
                     |...:.|.| |..|.   ::.|..|..:..|  |.|. |||     ..|:.||.|:
Mouse   136 FTIVLEDDGSQGTDVPTP-GNAENEPPEKEGLSPSQRTTATLDPTSPAPG-----EGPSGRKRRR 194

  Fly   115 QKAKQAPINPNPVIAP 130
            .....|.:.|.  :||
Mouse   195 APRVGASLTPE--LAP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32202NP_730354.2 None
TfptNP_001277310.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..72
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..210 21/76 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.