powered by:
Protein Alignment CG32202 and Hmgb4
DIOPT Version :9
Sequence 1: | NP_730354.2 |
Gene: | CG32202 / 326199 |
FlyBaseID: | FBgn0052202 |
Length: | 141 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_081312.2 |
Gene: | Hmgb4 / 69317 |
MGIID: | 1916567 |
Length: | 181 |
Species: | Mus musculus |
Alignment Length: | 67 |
Identity: | 16/67 - (23%) |
Similarity: | 26/67 - (38%) |
Gaps: | 14/67 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 KHGDDWRSVPMEAPHPKGKTEQKRRGPKPKNKQAADETGAPGSEPGPNTPAARKPRKQKAKQAPI 122
|..:.|||: :.|.|.|.|......|.:.:|.. .|....|:.|:::..:||.
Mouse 44 KCSEKWRSI---SKHEKAKYEALAELDKARYQQEM-----------MNYIGKRRKRRKRDPKAPR 94
Fly 123 NP 124
.|
Mouse 95 KP 96
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.