DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32202 and Hmgb4

DIOPT Version :10

Sequence 1:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_081312.2 Gene:Hmgb4 / 69317 MGIID:1916567 Length:181 Species:Mus musculus


Alignment Length:67 Identity:16/67 - (23%)
Similarity:26/67 - (38%) Gaps:14/67 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KHGDDWRSVPMEAPHPKGKTEQKRRGPKPKNKQAADETGAPGSEPGPNTPAARKPRKQKAKQAPI 122
            |..:.|||:   :.|.|.|.|......|.:.:|..           .|....|:.|:::..:||.
Mouse    44 KCSEKWRSI---SKHEKAKYEALAELDKARYQQEM-----------MNYIGKRRKRRKRDPKAPR 94

  Fly   123 NP 124
            .|
Mouse    95 KP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32202NP_730354.2 None
Hmgb4NP_081312.2 HMG-box_HMGB_rpt1 8..76 CDD:438794 10/45 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..100 5/17 (29%)
HMG-box_HMGB_rpt2 91..161 CDD:438795 3/6 (50%)

Return to query results.
Submit another query.