DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32202 and UBTFL1

DIOPT Version :9

Sequence 1:	NP_730354.2	Gene:	CG32202 / 326199	FlyBaseID:	FBgn0052202	Length:	141	Species:	Drosophila melanogaster
Sequence 2:	NP_001137447.1	Gene:	UBTFL1 / 642623	HGNCID:	14533	Length:	393	Species:	Homo sapiens

Alignment Length:	113	Identity:	26/113 - (23%)
Similarity:	47/113 - (41%)	Gaps:	27/113 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 NKKELMYKQLVEKLYD---RCQRI-QAENERCVMRVNGIKKIVRRRNHDVELLKRRLDKHGDDW- 63
            :.||:.:..:.|::.:   |.||| |::.:....:...::|     .:.|:|         |.|
Human   238 SSKEMQHLSVRERMVEIGRRWQRIPQSQKDHFKSQAEELQK-----QYKVKL---------DLWL 288

  Fly    64 -------RSVPMEAPHPKGKTEQKRRGPKPKNKQA-ADETGAPGSEPG 103
                   .:...|:.:.|||......||.|:.||| ...:.|.|.:.|
Human   289 KTLSPENYAAYKESTYAKGKNMAMTGGPDPRLKQADPQSSSAKGLQEG 336

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32202	NP_730354.2	None
UBTFL1	NP_001137447.1	HMGB-UBF_HMG-box	100..165	CDD:238686
		HMGB-UBF_HMG-box	223..285	CDD:238686	11/60 (18%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	308..393		10/29 (34%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5648
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900