powered by:
Protein Alignment CG32202 and tox4a
DIOPT Version :9
Sequence 1: | NP_730354.2 |
Gene: | CG32202 / 326199 |
FlyBaseID: | FBgn0052202 |
Length: | 141 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001921001.2 |
Gene: | tox4a / 559853 |
ZFINID: | ZDB-GENE-070912-576 |
Length: | 685 |
Species: | Danio rerio |
Alignment Length: | 73 |
Identity: | 20/73 - (27%) |
Similarity: | 24/73 - (32%) |
Gaps: | 19/73 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 PMEAPHPKGKTEQKRRGPKPKNKQAADETGAPGSEPGPNTPAARKPRKQKAKQAPINPNPVIAPP 131
|...|.| .:|.:..|.|...|...:|.|| .|...|||........| .:.||
Zfish 495 PGRQPPP---LQQMQGTPPPPRLQQMVQTQAP-------PPLQAKPRGGAGSSVGI----TVTPP 545
Fly 132 HQQPQPPL 139
|||
Zfish 546 -----PPL 548
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32202 | NP_730354.2 |
None |
tox4a | XP_001921001.2 |
PHA03369 |
<215..510 |
CDD:223061 |
4/17 (24%) |
HMG-box |
300..365 |
CDD:238037 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.