DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32202 and tfpt

DIOPT Version :9

Sequence 1:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001011268.1 Gene:tfpt / 496719 XenbaseID:XB-GENE-956157 Length:252 Species:Xenopus tropicalis


Alignment Length:159 Identity:43/159 - (27%)
Similarity:71/159 - (44%) Gaps:31/159 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKELMYKQLVEKLYDRCQRIQAENERCVMRVNGIKKIVRRRNHDVELLKRRLDKHGDDWRSVPM- 68
            ::||..::.: .|..||:.|:..|||.:.|::.::||.||...:...|.:.||.:|||:|...: 
 Frog    60 QRELHRRKFL-TLSRRCKEIELVNERILNRLHQVEKITRRLKQERRCLMKVLDAYGDDYRKSHLT 123

  Fly    69 -----EAPHP-----KGKTEQKRRGPKPKNKQ--------AADETG----APGSEPGPNTPAARK 111
                 |..||     .|.:|.:    .|:|::        |....|    :|.|......|.|:|
 Frog   124 FLLEDEGTHPHNSPAHGNSENE----PPENEELSVTPVCLAGQSLGLDINSPESPSQTEGPPAKK 184

  Fly   112 PRKQKAKQAPINPNPVIAPPHQQPQPPLL 140
            .:|.|.::   :.|.....|...|..|||
 Frog   185 RKKVKEEK---DQNGRRLTPSLLPSEPLL 210



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12074
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5299
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008187
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR35084
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.150

Return to query results.
Submit another query.