DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32202 and CG12104

DIOPT Version :9

Sequence 1:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster


Alignment Length:139 Identity:31/139 - (22%)
Similarity:51/139 - (36%) Gaps:37/139 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DRCQRIQAENERCVMR------------VNGIKKIVRRRNHD------VELLKRRLDKHGDDWRS 65
            |....|:.:|..|.:.            ::..:|.|....|:      |.|::....:..:...:
  Fly    89 DTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYRHQLSESEGT 153

  Fly    66 VPMEAPHPKGKTEQKRRGPKP------KNKQAADETGAPGSEPGPN-----TPAARK---PRKQK 116
            ...||| |...|.|    |.|      ::.:...::.....||.|:     |.|||.   .|:|.
  Fly   154 SEAEAP-PAVATNQ----PPPLVTTKLESVEDLQQSVDAQQEPPPDQIQLLTEAARVQKCTREQC 213

  Fly   117 AKQAPINPN 125
            .|.|.|||:
  Fly   214 NKPAIINPD 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32202NP_730354.2 None
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 8/50 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.