DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32202 and ubtf

DIOPT Version :9

Sequence 1:	NP_730354.2	Gene:	CG32202 / 326199	FlyBaseID:	FBgn0052202	Length:	141	Species:	Drosophila melanogaster
Sequence 2:	NP_001005395.1	Gene:	ubtf / 368509	ZFINID:	ZDB-GENE-030616-252	Length:	735	Species:	Danio rerio

Alignment Length:	106	Identity:	24/106 - (22%)
Similarity:	37/106 - (34%)	Gaps:	29/106 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly    36 NGIKKIVRRRNHDVEL----LKRRLDKHGDDWRSVPM----------EAPHPKGKTE-------- 78
            ||.:|..:....:.||    :|.|:.:.|..|:.:|.          |......|.|
Zfish   563 NGYQKFSQEMLSNGELNHLPMKERMGEIGGRWQRLPQKDKDRYKRIAEEKQRLYKVELEQWLTSI 627

  Fly    79 --QKRRGPKPKNKQAADETGAPGSEPGPNTPAARKPRKQKA 117
              |:|...|..|......|..||     .|.|..||:.:::
Zfish   628 SSQERAAYKEYNSLKRRSTAKPG-----GTNAKVKPKAKRS 663

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32202	NP_730354.2	None
ubtf	NP_001005395.1	HMGB-UBF_HMG-box	104..168	CDD:238686
		HMGB-UBF_HMG-box	189..254	CDD:238686
		HMGB-UBF_HMG-box	292..351	CDD:238686
		HMGB-UBF_HMG-box	400..463	CDD:238686
		HMG_box_5	469..552	CDD:291548
		HMGB-UBF_HMG-box	557..621	CDD:238686	13/57 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5648
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900