powered by:
Protein Alignment CG32202 and hmg20a
DIOPT Version :9
Sequence 1: | NP_730354.2 |
Gene: | CG32202 / 326199 |
FlyBaseID: | FBgn0052202 |
Length: | 141 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001082803.1 |
Gene: | hmg20a / 326908 |
ZFINID: | ZDB-GENE-030131-5107 |
Length: | 291 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 19/74 - (25%) |
Similarity: | 29/74 - (39%) |
Gaps: | 19/74 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 KHGDDWRSVPMEAPHPKGKTEQKRRGPKPKNKQAADETGAPGSEPGPNTPAAR---KPRKQKAKQ 119
::|| |.|.....|:.:|| |:...::.|| ..|.|...| :.|:|...:
Zfish 18 RNGD-------EKPRRSSWTKGRRR------KKPLKDSNAP---KAPLTGYVRFMNERREQLRAE 66
Fly 120 APINPNPVI 128
.|..|.|.|
Zfish 67 RPDVPFPEI 75
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32202 | NP_730354.2 |
None |
hmg20a | NP_001082803.1 |
HMGB-UBF_HMG-box |
45..110 |
CDD:238686 |
10/34 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.