DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32202 and HMGB1

DIOPT Version :10

Sequence 1:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_002119.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens


Alignment Length:68 Identity:18/68 - (26%)
Similarity:27/68 - (39%) Gaps:23/68 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PKGKTEQKRRGPK-PKNKQAA-------DETGAPGSEPG--------------PNTPA-ARKPRK 114
            |||:|::|.:.|. ||...:|       ......|..||              .||.| .::|.:
Human    81 PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYE 145

  Fly   115 QKA 117
            :||
Human   146 KKA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32202NP_730354.2 None
HMGB1NP_002119.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000250|UniProtKB:P63158 1..97 7/15 (47%)
LPS binding (delipidated). /evidence=ECO:0000269|PubMed:21660935 3..15
HMG-box_HMGB_rpt1 8..76 CDD:438794
Nuclear localization signal (NLS) 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..95 6/13 (46%)
LPS binding (Lipid A). /evidence=ECO:0000269|PubMed:21660935 80..96 6/14 (43%)
Cytokine-stimulating activity. /evidence=ECO:0000269|PubMed:12765338 89..108 4/18 (22%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 12/56 (21%)
Binding to AGER/RAGE. /evidence=ECO:0000250|UniProtKB:P63159 150..183
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..215
Nuclear localization signal (NLS) 2. /evidence=ECO:0000250|UniProtKB:P63159 178..184
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.