DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32202 and Ubtf

DIOPT Version :10

Sequence 1:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001121162.1 Gene:Ubtf / 25574 RGDID:3927 Length:764 Species:Rattus norvegicus


Alignment Length:112 Identity:29/112 - (25%)
Similarity:46/112 - (41%) Gaps:26/112 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLNKKELMYKQLVEKLYD---RCQRI-QAENERCVMRVNGIKKIVRRRNHDVELLKRRLDKHGDD 62
            ||:..||.:..|.|::.:   |.||| |::.|.       .||:...:       :|:...|.|.
  Rat   582 LLSNGELNHLPLKERMVEIGSRWQRISQSQKEH-------YKKLAEEQ-------QRQYKVHLDL 632

  Fly    63 W--------RSVPMEAPHPKGKTEQKRRGPKPKNKQAADETGAPGSE 101
            |        |:...|....|.|...|.|||.||:.:...::.:...|
  Rat   633 WVKSLSPQDRAAYKEYISNKRKNMTKLRGPNPKSSRTTLQSKSESEE 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32202NP_730354.2 None
UbtfNP_001121162.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
HMG-box_UBF1_rpt1-like 109..185 CDD:438814
HMG-box_UBF1_rpt2 196..270 CDD:438815
HMG-box_UBF1_rpt3 297..379 CDD:438816
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..411
HMG-box_UBF1_rpt4 405..470 CDD:438817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 456..488
HMG_box_5 479..562 CDD:434287
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 546..576
HMG-box_UBF1_rpt6-like 565..650 CDD:438819 20/81 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 648..764 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.