powered by:
Protein Alignment CG32202 and SPBC28F2.11
DIOPT Version :9
Sequence 1: | NP_730354.2 |
Gene: | CG32202 / 326199 |
FlyBaseID: | FBgn0052202 |
Length: | 141 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_595672.1 |
Gene: | SPBC28F2.11 / 2540337 |
PomBaseID: | SPBC28F2.11 |
Length: | 310 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 65 |
Identity: | 17/65 - (26%) |
Similarity: | 31/65 - (47%) |
Gaps: | 13/65 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 EQKRRGPKPKNKQAADETG--APGSEP---------GPNTPAARKPRKQKAKQAPINPNPVIAPP 131
||..:.||.|:.::...|. .|.|:| .||.|:|::.:|::.|.: ..:.:..||
pombe 242 EQHAKKPKRKHTRSTVPTSNVEPVSQPQPSPDKIVSSPNPPSAKREKKKRRKSS--MSSSITTPP 304
Fly 132 131
pombe 305 304
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32202 | NP_730354.2 |
None |
SPBC28F2.11 | NP_595672.1 |
NHP6B |
<108..251 |
CDD:227935 |
4/8 (50%) |
HMGB-UBF_HMG-box |
117..184 |
CDD:238686 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.