DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32202 and SPBC28F2.11

DIOPT Version :9

Sequence 1:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_595672.1 Gene:SPBC28F2.11 / 2540337 PomBaseID:SPBC28F2.11 Length:310 Species:Schizosaccharomyces pombe


Alignment Length:65 Identity:17/65 - (26%)
Similarity:31/65 - (47%) Gaps:13/65 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EQKRRGPKPKNKQAADETG--APGSEP---------GPNTPAARKPRKQKAKQAPINPNPVIAPP 131
            ||..:.||.|:.::...|.  .|.|:|         .||.|:|::.:|::.|.:  ..:.:..||
pombe   242 EQHAKKPKRKHTRSTVPTSNVEPVSQPQPSPDKIVSSPNPPSAKREKKKRRKSS--MSSSITTPP 304

  Fly   132  131
            pombe   305  304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32202NP_730354.2 None
SPBC28F2.11NP_595672.1 NHP6B <108..251 CDD:227935 4/8 (50%)
HMGB-UBF_HMG-box 117..184 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.