DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32202 and hmg-5

DIOPT Version :10

Sequence 1:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_501245.1 Gene:hmg-5 / 177543 WormBaseID:WBGene00001975 Length:204 Species:Caenorhabditis elegans


Alignment Length:92 Identity:21/92 - (22%)
Similarity:34/92 - (36%) Gaps:28/92 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VRRRNHDVELLKRRLDKHGDDWRSVPMEAPHPKGKTEQKRRGPKPKNKQAADETGAPGSEPGPNT 106
            :..::...||.|....:..||:..:..|        |||:.....|.|:|              .
 Worm    70 ISEKDKYTELSKNYNAQKLDDFMKLSTE--------EQKKLVDSAKEKKA--------------E 112

  Fly   107 PAAR---KPRKQKAKQAPINPNPVIAP 130
            .|:|   |.|::|.||   :..|.:.|
 Worm   113 RASRRHAKERREKRKQ---SGRPSVPP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32202NP_730354.2 None
hmg-5NP_501245.1 HMG-box_SF 35..81 CDD:438789 2/10 (20%)
HMG-box_SF 132..197 CDD:469606 2/5 (40%)

Return to query results.
Submit another query.