DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32202 and hmg-1.1

DIOPT Version :9

Sequence 1:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001370073.1 Gene:hmg-1.1 / 175081 WormBaseID:WBGene00001971 Length:95 Species:Caenorhabditis elegans


Alignment Length:37 Identity:13/37 - (35%)
Similarity:16/37 - (43%) Gaps:1/37 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EQKRRGPKPKNKQAADETGAPGSEPGPNTPAARKPRK 114
            |.:.|..|| ....||...|.|.|.|..|..:|..:|
 Worm    41 ENRERIKKP-GMGVADVAKAAGVEWGKLTDKSRWEKK 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32202NP_730354.2 None
hmg-1.1NP_001370073.1 HMGB-UBF_HMG-box 28..89 CDD:238686 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.