powered by:
Protein Alignment CG32202 and Hmgb3
DIOPT Version :9
Sequence 1: | NP_730354.2 |
Gene: | CG32202 / 326199 |
FlyBaseID: | FBgn0052202 |
Length: | 141 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001280552.1 |
Gene: | Hmgb3 / 15354 |
MGIID: | 1098219 |
Length: | 200 |
Species: | Mus musculus |
Alignment Length: | 92 |
Identity: | 19/92 - (20%) |
Similarity: | 26/92 - (28%) |
Gaps: | 44/92 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 PKGK------------TEQKRRGPK--------------------PKNKQAADETGAPG------ 99
|||| .|.|::.|: .|.|...||.....
Mouse 9 PKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSSKEKSKFDEMAKADKVRYDR 73
Fly 100 --SEPGPNTPAARKPRKQKAKQAPINP 124
.:.|| |:..:|:|...||..|
Mouse 74 EMKDYGP----AKGGKKKKDPNAPKRP 96
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.