DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32202 and Hmgb3

DIOPT Version :10

Sequence 1:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_032279.1 Gene:Hmgb3 / 15354 MGIID:1098219 Length:200 Species:Mus musculus


Alignment Length:92 Identity:19/92 - (20%)
Similarity:26/92 - (28%) Gaps:44/92 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PKGK------------TEQKRRGPK--------------------PKNKQAADETGAPG------ 99
            ||||            .|.|::.|:                    .|.|...||.....      
Mouse     9 PKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSSKEKSKFDEMAKADKVRYDR 73

  Fly   100 --SEPGPNTPAARKPRKQKAKQAPINP 124
              .:.||    |:..:|:|...||..|
Mouse    74 EMKDYGP----AKGGKKKKDPNAPKRP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32202NP_730354.2 None
Hmgb3NP_032279.1 HMG-box_HMGB_rpt1 13..76 CDD:438794 7/62 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..97 8/30 (27%)
HMG-box_HMGB_rpt2 91..161 CDD:438795 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..200
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.