DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32202 and Hmgb1

DIOPT Version :9

Sequence 1:	NP_730354.2	Gene:	CG32202 / 326199	FlyBaseID:	FBgn0052202	Length:	141	Species:	Drosophila melanogaster
Sequence 2:	NP_001300823.1	Gene:	Hmgb1 / 15289	MGIID:	96113	Length:	215	Species:	Mus musculus

Alignment Length:	68	Identity:	18/68 - (26%)
Similarity:	27/68 - (39%)	Gaps:	23/68 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly    73 PKGKTEQKRRGPK-PKNKQAA-------DETGAPGSEPG--------------PNTPA-ARKPRK 114
            |||:|::|.:.|. ||...:|       ......|..||              .||.| .::|.:
Mouse    81 PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYE 145

  Fly   115 QKA 117
            :||
Mouse   146 KKA 148

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32202	NP_730354.2	None
Hmgb1	NP_001300823.1	Sufficient for interaction with HAVCR2. /evidence=ECO:0000269\|PubMed:22842346	1..97		7/15 (47%)
		Heparin-binding. /evidence=ECO:0000250\|UniProtKB:P10103	1..10
		LPS binding (delipidated). /evidence=ECO:0000250\|UniProtKB:P09429	3..15
		HMG_box_2	6..78	CDD:401091
		NLS 1. /evidence=ECO:0000250\|UniProtKB:P63159	27..43
		Nuclear localization signal (NLS) 1. /evidence=ECO:0000250\|UniProtKB:P63159	27..43
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	76..95		6/13 (46%)
		LPS binding (Lipid A). /evidence=ECO:0000250\|UniProtKB:P09429	80..96		6/14 (43%)
		Cytokine-stimulating activity. /evidence=ECO:0000250\|UniProtKB:P09429	89..108		4/18 (22%)
		HMG_box	95..162	CDD:395407	12/54 (22%)
		Binding to AGER/RAGE. /evidence=ECO:0000250\|UniProtKB:P63159	150..183
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	161..215
		NLS 2. /evidence=ECO:0000250\|UniProtKB:P63159	178..184
		Nuclear localization signal (NLS) 2. /evidence=ECO:0000250\|UniProtKB:P63159	178..184
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5648
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900