DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32202 and HMG20A

DIOPT Version :9

Sequence 1:	NP_730354.2	Gene:	CG32202 / 326199	FlyBaseID:	FBgn0052202	Length:	141	Species:	Drosophila melanogaster
Sequence 2:	NP_001291433.1	Gene:	HMG20A / 10363	HGNCID:	5001	Length:	347	Species:	Homo sapiens

Alignment Length:	90	Identity:	22/90 - (24%)
Similarity:	34/90 - (37%)	Gaps:	28/90 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly    58 KHGDDWRSVPMEAPHPKGKTEQKRRGPKPKNKQAADETGAPGSEPGPNTPAAR---KPRKQKAKQ 119
            :|.|:.||       .:|...:.|:..||..     ::.||.|   |.|...|   :.|:|...:
Human    75 RHEDEQRS-------KRGGWSKGRKRKKPLR-----DSNAPKS---PLTGYVRFMNERREQLRAK 124

  Fly   120 APINPNPVIA----------PPHQQ 134
            .|..|.|.|.          ||.::
Human   125 RPEVPFPEITRMLGNEWSKLPPEEK 149

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32202	NP_730354.2	None
HMG20A	NP_001291433.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..113		13/52 (25%)
		DUF5401	<59..313	CDD:375164	22/90 (24%)
		HMGB-UBF_HMG-box	103..168	CDD:238686	13/50 (26%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	179..211
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5648
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900