DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and NRG2

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_053585.1 Gene:NRG2 / 9542 HGNCID:7998 Length:858 Species:Homo sapiens


Alignment Length:107 Identity:30/107 - (28%)
Similarity:53/107 - (49%) Gaps:31/107 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 YCLNDGTCFTVKIHNEILYNCECALGFMGPRC--------------------EYKEIDGSYLPTR 114
            ||:|.|.|:.::..|::  :|:|..||.|.||                    |.||.:..|   :
Human   352 YCVNGGVCYYIEGINQL--SCKCPNGFFGQRCLEKLPLRLYMPDPKQKHLGFELKEAEELY---Q 411

  Fly   115 NRVMLEKASIVSGATLALLFMAMCCVVLYLRHEKLQKQKLHD 156
            .||:     .::|..:|||.:.:.|||.|.:.:| |::::|:
Human   412 KRVL-----TITGICVALLVVGIVCVVAYCKTKK-QRKQMHN 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
NRG2NP_053585.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96
I-set 239..328 CDD:254352
Ig_Pro_neuregulin 253..326 CDD:143227
PHA02887 <343..383 CDD:165214 13/32 (41%)
Neuregulin 406..845 CDD:280343 14/51 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..543
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..593
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 655..689
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..796
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 809..858
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40711
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.