DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krn and Nrg2

DIOPT Version :9

Sequence 1:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001129623.2 Gene:Nrg2 / 432361 RGDID:1303302 Length:860 Species:Rattus norvegicus


Alignment Length:90 Identity:27/90 - (30%)
Similarity:48/90 - (53%) Gaps:6/90 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 YCLNDGTCFTVKIHNEILYNCECALGFMGPRCEYKEIDGSYLP----TRNRVMLEKASIVSGATL 130
            ||:|.|.|:.::..|::  :|:|..||.|.||..|.....|:|    ....:..::...::|..:
  Rat   368 YCVNGGVCYYIEGINQL--SCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKRVLTITGICV 430

  Fly   131 ALLFMAMCCVVLYLRHEKLQKQKLH 155
            |||.:.:.|||.|.:.:|.::|..|
  Rat   431 ALLVVGIVCVVAYCKTKKQRRQMHH 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrnNP_524129.1 None
Nrg2NP_001129623.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114
IG 259..344 CDD:214652
EGF_CA <369..397 CDD:238011 10/29 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 461..480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..545
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 663..682
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 712..798
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..860
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44847
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.