DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Krn and egf

DIOPT Version :9

Sequence 1:	NP_524129.1	Gene:	Krn / 326198	FlyBaseID:	FBgn0052179	Length:	217	Species:	Drosophila melanogaster
Sequence 2:	NP_001352456.1	Gene:	egf / 403045	ZFINID:	ZDB-GENE-070922-1	Length:	1177	Species:	Danio rerio

Alignment Length:	136	Identity:	40/136 - (29%)
Similarity:	58/136 - (42%)	Gaps:	25/136 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    48 STTPRPNVTFP------IFACPPTYVAWYCLNDGTCFTVKIHNEILYNCECALGFMGPRCEYKEI 106
            ||...|:||..      :.:||.|:.: |||.||.||.......  |.|.|.||:||.||::.::
Zfish   954 STASPPDVTSTLQHKNGVQSCPSTHDS-YCLYDGVCFYFPDMES--YACNCVLGYMGERCQFSDL 1015

  Fly   107 DGSYLPT----RNRVMLEKASIVSGATLALLFMAMCCVVLY----------LRHEKLQKQKLHDS 157
            :...|..    :.|.|:....||  ..:.:|.:|.|....|          |:....:.....||
Zfish  1016 EWWELQQAEEGKRRNMVIAVCIV--LLITILSIAACITFCYRPKRHFGGCSLQDSVGEMSASEDS 1078

  Fly   158 TTTTTT 163
            .|.|||
Zfish  1079 FTETTT 1084

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Krn	NP_524129.1	None
egf	NP_001352456.1	NHL	34..>197	CDD:302697
		NHL repeat	81..121	CDD:271320
		NHL repeat	123..160	CDD:271320
		LY	156..197	CDD:214531
		vWFA	<351..394	CDD:320736
		FXa_inhibition	441..476	CDD:317114
		LY	506..546	CDD:214531
		LY	549..589	CDD:214531
		LY	590..629	CDD:214531
		LY	634..676	CDD:214531
		FXa_inhibition	745..780	CDD:317114
		EGF_3	865..901	CDD:315598
		EGF_3	907..942	CDD:315598
		PHA02887	<959..1058	CDD:333467	31/103 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910